PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400018138
Common NameLOC102579699
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family MIKC_MADS
Protein Properties Length: 215aa    MW: 24859.7 Da    PI: 8.2119
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400018138genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF90.11.1e-281059251
                          ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                          rien + rqvtfskRrng+lKKA+ELSvLCda+v +iifs+++klye+s+
  PGSC0003DMP400018138 10 RIENATSRQVTFSKRRNGLLKKAFELSVLCDAQVGLIIFSPRDKLYEFST 59
                          8***********************************************96 PP

2K-box71.82e-2480171697
                 K-box   6 gksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaL 94 
                           + + e++++ +l+++ + L k+ie L++++R+llGe+Les+sl+eLqq+e+qLe+s++ iR++K+e+++eqi +l++  kel++en +L
  PGSC0003DMP400018138  80 NPDMEQNNMHNLKHNTSSLMKKIELLEKSKRKLLGESLESCSLEELQQMEHQLERSINIIRARKMEVFREQIVRLKENVKELSSENVML 168
                           4458999*********************************************************************************9 PP

                 K-box  95 rkk 97 
                            +k
  PGSC0003DMP400018138 169 LEK 171
                           987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.2E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006630.684161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.12E-32374IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-28323IPR002100Transcription factor, MADS-box
CDDcd002657.07E-41375No hitNo description
PfamPF003191.0E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-283859IPR002100Transcription factor, MADS-box
PfamPF014863.1E-2483172IPR002487Transcription factor, K-box
PROSITE profilePS5129714.81188178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 215 aa     Download sequence    Send to blast
MVRGKTEMRR IENATSRQVT FSKRRNGLLK KAFELSVLCD AQVGLIIFSP RDKLYEFSTS  60
SMQEIIERYQ RHTKDIQCEN PDMEQNNMHN LKHNTSSLMK KIELLEKSKR KLLGESLESC  120
SLEELQQMEH QLERSINIIR ARKMEVFREQ IVRLKENVKE LSSENVMLLE KCGGLEMQQT  180
SGGEDVSIVI SSEKSYVETE LFIGLPESCK TKRP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A3e-17372271MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B3e-17372271MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C3e-17372271MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_D3e-17372271MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3kov_A3e-17372271Myocyte-specific enhancer factor 2A
3kov_B3e-17372271Myocyte-specific enhancer factor 2A
3kov_I3e-17372271Myocyte-specific enhancer factor 2A
3kov_J3e-17372271Myocyte-specific enhancer factor 2A
3mu6_A2e-17372271Myocyte-specific enhancer factor 2A
3mu6_B2e-17372271Myocyte-specific enhancer factor 2A
3mu6_C2e-17372271Myocyte-specific enhancer factor 2A
3mu6_D2e-17372271Myocyte-specific enhancer factor 2A
3p57_A3e-17372271Myocyte-specific enhancer factor 2A
3p57_B3e-17372271Myocyte-specific enhancer factor 2A
3p57_C3e-17372271Myocyte-specific enhancer factor 2A
3p57_D3e-17372271Myocyte-specific enhancer factor 2A
3p57_I3e-17372271Myocyte-specific enhancer factor 2A
3p57_J3e-17372271Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015161756.11e-155PREDICTED: MADS-box protein SOC1-like isoform X1
RefseqXP_006341728.11e-155PREDICTED: MADS-box protein SOC1-like isoform X1
SwissprotO646456e-79SOC1_ARATH; MADS-box protein SOC1
TrEMBLM1AND51e-155M1AND5_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000265761e-154(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4024625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.14e-64AGAMOUS-like 20
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]